Data · dataset · 2026
Novel peptide identified from the skin of Kaloula pulchra frog
Listed in ScienceDB
A novel peptide which was named Cath-KP was identified from the skin of Kaloula pulchra frog.
Description
Cath-KP belongs to the Cathelicidin family with 37 amino acid residues (GCSGRFCNLFNNRRPGRLTLIHRPGGDKRTSTGLIYV). Cath-KP possesses a favorable antioxidant capability in both in vivo and in vitro.
Cath-KP succesfully across the blood-brain barrier, strengthen protection against oxidative stress by promoting the expression of antioxidant enzymes and alleviating the accumulation of mitochondrial and intracellular ROS through regulating the activation of Sirt/Nrf2, FAK, and p38 signaling pathways, thereby ameliorate the damage towards nerve cells caused by stimulus. Cath-KP also affects the apoptosis process via modulating the expression of related protein including Bax and Bcl-2.
Read the rest (1 more)
In vivo, Cath-KP exerts a promising neuroprotective properties in MPTP-induced PD mice.
Links
Where it is published
- DOI doi.org/10.57760/sciencedb.j00139.00068 ↗
DOI / persistent id · from scidb cn
Catalogue records · 1
- OAI-PMH record scidb.cn/oai?verb=GetRecord&metadataPrefix=oai_dc&identifier=10.57760%2… ↗
metadata API · from scidb cn
Topics
- From keywords
- Earth & Environmental Science · Engineering · Humanities · Life Sciences · Social Science
Provenance · 1 source records, 10 field assertions
| Source | Key | Last seen | Raw |
|---|---|---|---|
| ScienceDB | 10.57760/sciencedb.j00139.00068 | 10 d ago | JSON v1 |
| Field | Assertion | Extractor | Evidence |
|---|---|---|---|
| access_level | source · scidb cn | connector:scidb_cn@1.0.0 | |
| concepts[field].local:field:earth-environmental | mapping · scidb cn | connector:scidb_cn@1.0.0 | |
| concepts[field].local:field:engineering | mapping · scidb cn | connector:scidb_cn@1.0.0 | |
| concepts[field].local:field:humanities | mapping · scidb cn | connector:scidb_cn@1.0.0 | |
| concepts[field].local:field:life-sciences | mapping · scidb cn | connector:scidb_cn@1.0.0 | |
| concepts[field].local:field:social-science | mapping · scidb cn | connector:scidb_cn@1.0.0 | |
| description | source · scidb cn | connector:scidb_cn@1.0.0 | /metadata/dc/description |
| license_text | source · scidb cn | connector:scidb_cn@1.0.0 | |
| publication_date | source · scidb cn | connector:scidb_cn@1.0.0 | |
| title | source · scidb cn | connector:scidb_cn@1.0.0 | /metadata/dc/title |