QUB-2825: A novel bioactive peptide from the skin secretion of Phyllomedusa hypochondrialis

Due to their potential as alternative candidates for the treatment of multi-drug resistance microbes. The dermaseptins consist of a superfamily within amphibian AMPs, which also possess anticancer activities with weak haemolytic effect. <br><br>My research aims at searching for a novel bioactive peptide from the skin secretion of the Northern Orange-legged Leaf Frog Phyllomedusa hypochondrialis using molecular cloning.

According to the obtained sequence, target peptide was synthesised by solid phase peptide synthesiser and purified by RP-HPLC. The product peptide was then identified by MALDI-TOF. At last, the synthesised peptide was used to test for its biological functions including antimicrobial, anticancer and haemolytic activities.<br><br>A 28 amino-acid-residue novel peptide QUB-2825, whose sequence is ALWKSLLKNVGVAAGKAALNAVTGMVNQ-NH2, which belongs to the dermaseptin superfamily, was discovered in the skin secretion of Phyllomedusa hypochondrialis.