Data · dataset · 2026
Identification and bio-evaluation of an antimicrobial peptide from the skin secretion of Phyllomedusa tarsius
Listed in ZivaHub and Deakin Research Online and DMU Figshare and UCL Research Data Repository — shown once because both records carry DOI 10.17034/32630004.v1
Antimicrobial peptides (AMPs), as a large classification of biologically active peptides, showed a broad-spectrum efficacy against various microorganisms.
Description
Although the antibacterial activity of these peptides already has been proven, studies have shown that antibacterial peptides can also play other roles. In this study, a novel peptide was identified from the skin secretion of the tree frog from South America, Phyllomedusa tarsius.
After mRNA was isolated from skin secretions, a cDNA library was established and subjected to molecular cloning technology. The sequence of an active peptide, QUB-3128 (GLFKTLIKGAGKMLGHVAKQFLGSQGQPES) was deduced from the cloned cDNA encoding a dermaseptin precursor. Subsequently, this peptide was synthesised by solid-phase synthesis, and the purified synthetic form was used for biological assays.
Read the rest (2 more)
Results showed that this peptide possessed ideal inhibitory effects on S. aureus (NCTC 10788), E. coli (ATCC 8739) and C. albicans (ATCC 10231), with MIC concentrations of 4 µM, 8 µM and 128 µM, respectively. Also, it showed antiproliferative activities against two human cancer cell lines, H838 and PC-3, where the IC50 values against both were approximately 2 µM. However, this peptide demonstrated observable haemolytic effects at higher peptide concentrations (≥ 128 µM) on horse blood cells.
Altogether, this dermaseptin peptide with antimicrobial and antiproliferative activity could be an ideal candidate for developing new antibacterial and anticancer reagents.
Links
Where it is published
- DOI doi.org/10.17034/32630004.v1 ↗
DOI / persistent id · from zivahub uct ac za
Catalogue records · 1
- OAI-PMH record api.figshare.com/v2/oai?verb=GetRecord&metadataPrefix=oai_dc&identifier=oai%3Af… ↗
metadata API · from zivahub uct ac za
Topics
- From keywords
- Earth & Environmental Science · Earth & Environmental Science · Earth & Environmental Science · Earth & Environmental Science
- Inferred from text
- Cancer 75%
Provenance · 4 source records, 9 field assertions
| Source | Key | Last seen | Raw |
|---|---|---|---|
| ZivaHub | oai:figshare.com:article/32630004 | 11 d ago | JSON v1 |
| Deakin Research Online | oai:figshare.com:article/32630004 | 11 d ago | JSON v1 |
| DMU Figshare | oai:figshare.com:article/32630004 | 11 d ago | JSON v1 |
| UCL Research Data Repository | oai:figshare.com:article/32630004 | 11 d ago | JSON v1 |
| Field | Assertion | Extractor | Evidence |
|---|---|---|---|
| concepts[disease].local:disease:cancer | enrichment · zivahub uct ac za | keyword-concept-rules@1.0.0 | title+description (75%) |
| concepts[field].local:field:earth-environmental | mapping · zivahub uct ac za | connector:zivahub_uct_ac_za@1.0.0 | |
| concepts[field].local:field:earth-environmental | mapping · dro deakin edu au | connector:dro_deakin_edu_au@1.0.0 | |
| concepts[field].local:field:earth-environmental | mapping · figshare dmu ac uk | connector:figshare_dmu_ac_uk@1.0.0 | |
| concepts[field].local:field:earth-environmental | mapping · rdr ucl ac uk | connector:rdr_ucl_ac_uk@1.0.0 | |
| description | source · zivahub uct ac za | connector:zivahub_uct_ac_za@1.0.0 | /metadata/dc/description |
| license_text | source · zivahub uct ac za | connector:zivahub_uct_ac_za@1.0.0 | |
| publication_date | source · zivahub uct ac za | connector:zivahub_uct_ac_za@1.0.0 | |
| title | source · zivahub uct ac za | connector:zivahub_uct_ac_za@1.0.0 | /metadata/dc/title |